SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2HEM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2HEM8
Domain Number 1 Region: 84-288
Classification Level Classification E-value
Superfamily ITPase-like 0.0000000000000523
Family YjjX-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2HEM8
Sequence length 304
Comment (tr|Q2HEM8|Q2HEM8_CHAGB) Uncharacterized protein {ECO:0000313|EMBL:EAQ93091.1} KW=Complete proteome; Reference proteome OX=306901 OS=6347 / NRRL 1970) (Soil fungus). GN=CHGG_01326 OC=Chaetomium.
Sequence
MSHIPTTTPASAAAAPKPTNPNPDTKPTNPLYNPTLPTDRSLFRQPLRPAPDATALCAPY
IPSPSTLPTLTTTTTRPPNPNNVLLLIPTANASKTALLTAHLAATRPPHITSLTHLQIPA
DSGVGEQPYDGAGPRGAFNRVVGAVHALQRQAERGTYGEVLSGVGTVVVGAVENFVRRER
AAGEGGVLVPVDYGVVVFCRVSLAPGEERARWEWRVGVSKGVMVPREYWRAAEGFGFEDD
ERMHGKVTVGEVLAANLGVDKADWFLSLMGVSRYDLLRDAMEEMEVPWPAAGNAPVAVSK
AFGA
Download sequence
Identical sequences Q2HEM8
XP_001220547.1.25026 CHGT_01326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]