SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2L0X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2L0X4
Domain Number 1 Region: 19-128
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.09e-24
Family N-acetyl transferase, NAT 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2L0X4
Sequence length 139
Comment (tr|Q2L0X4|Q2L0X4_BORA1) Acetyltransferase {ECO:0000313|EMBL:CAJ49401.1} KW=Complete proteome; Reference proteome OX=360910 OS=Bordetella avium (strain 197N). GN=BAV1793 OC=Alcaligenaceae; Bordetella.
Sequence
MIGIIREYLGSTRVSLEYQNYEEELDGLPGRYAAPRGLMLMAWSKAGVVGCGGFREVDAR
TCEMKRVYVRPEARGRQLGRQLMERILQEARAAGYGRICLDVLPEFLAAQYLYESLGFQA
AEPVTENPVPGTRFLGRDL
Download sequence
Identical sequences Q2L0X4
360910.BAV1793 gi|187478287|ref|YP_786311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]