SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2NIK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2NIK0
Domain Number 1 Region: 152-333
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.62e-43
Family G proteins 0.00000784
Further Details:      
 
Domain Number 2 Region: 2-157
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 1.83e-43
Family Obg GTP-binding protein N-terminal domain 0.0000131
Further Details:      
 
Domain Number 3 Region: 349-418
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 3.4e-20
Family Obg GTP-binding protein C-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2NIK0
Sequence length 419
Comment (sp|Q2NIK0|OBG_AYWBP) GTP-binding protein Obg {ECO:0000255|HAMAP-Rule:MF_01454} KW=Complete proteome OX=322098 OS=Aster yellows witches'-broom phytoplasma (strain AYWB). GN=AYWB_626; OC=Candidatus Phytoplasma asteris.
Sequence
MHFVDEAFNEVFAGNGGHGIVAFRREKYVAFGGPAGGNGGNGGSVIFVGDKGENTLLKLK
YQKHLKAPHGINGKNKGQNGANAPHLYVKVPLGTVFYTADNKFLGEILYDQQTLVIAKGG
KGGKGNKALATFKNQAPSYSEKGDLGESFKIKTELKVLADIGLLGFPSVGKSSLISAISK
AQPKVASYPFTTIKPHLGVVEVDGFSFVVADLPGLIENAHLGCGMGIQFLKHIERCRVLV
HILSMESSNPYQDFQTLNQELKQYNPQLLLKKQIIVTNKMDLPDSLKKLTLLKQKIKGQP
IIPLSLVSFDNLEILKYKMSSFLQNTPLEVNPNNNNDFKLYTLTDNLKTISVIKESDSVF
VVSGNQVEIFFHRTDFNNEESVKRFNRILKKIGMEEQLQKKGAKPGDQVKICDRLFDFL
Download sequence
Identical sequences Q2NIK0
322098.AYWB_626 WP_011412905.1.27578 gi|85057906|ref|YP_456822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]