SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2QXZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2QXZ2
Domain Number 1 Region: 298-381
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-19
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 8-55,95-128,187-214
Classification Level Classification E-value
Superfamily POZ domain 7.32e-18
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2QXZ2
Sequence length 494
Comment (sp|Q2QXZ2|NH52_ORYSJ) BTB/POZ domain and ankyrin repeat-containing protein NH5.2 {ECO:0000305} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=Os12g0138500 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MSSEDSLKSLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPN
HQPPPPPPPPLNWPTAGGGGGGSGGGGRGGAGGGGGAPATPELVIPVSSIRYEVLVLVLQ
FLYSGQASVAAPKSGPLPGCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQL
ESMVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEI
RAKSPLAAAAAPRSPFLTHHYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEG
LDLDDALAVHYAVQHCNRDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLL
DHHADPNSRTLDGVTPLDVLRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTR
DDGAPVTGGEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAVAAGEGRKSNNGR
GSPPPAMYFPNGFA
Download sequence
Identical sequences Q2QXZ2
LOC_Os12g04410.1|13112.m00421|protein 39947.LOC_Os12g04410.1 LOC_Os12g04410.1|PACid:21937439 XP_015619624.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]