SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2RHE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2RHE4
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.08e-75
Family Phosphate binding protein-like 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2RHE4
Sequence length 286
Comment (tr|Q2RHE4|Q2RHE4_MOOTA) Menaquinone biosynthetic enzyme MqnA {ECO:0000256|HAMAP-Rule:MF_00995} KW=Complete proteome; Reference proteome OX=264732 OS=Moorella thermoacetica (strain ATCC 39073 / JCM 9320). GN=Moth_1845 OC=Thermoanaerobacteraceae; Moorella group; Moorella.
Sequence
MDWPRLGRVGYLNCLPLFYPLETGRVKLPARIVADHPAVLNKAFRQGELEVTAVSSLAYG
QFAEDALVLPGLSISCRGRVGSVFLLSRVPAKELGGRPLSLTPYSATSVVLLRILLQRLY
HVAPDFFTRPTGSPPDWGRPEALLTIGDEALQVVRTGCYPFVYDLGEEWYRLTGKPMVFA
LWVARKDFAAAHPEKLAAIWRALQEAKAWGKGHPGTLAATGARHLGVEPEFIEDYFALLN
YDLDWPHLEGLLTFYGLAHGEGFLAHPVALEIWGVDNERNYRLQSA
Download sequence
Identical sequences A0A1J5NEA0 Q2RHE4
WP_011393345.1.24029 WP_011393345.1.52901 WP_011393345.1.90723 YP_430688.1.14147 gi|83590679|ref|YP_430688.1| 264732.Moth_1845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]