SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2S4F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2S4F4
Domain Number 1 Region: 8-161
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000000000000848
Family Glycosyl transferases group 1 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2S4F4
Sequence length 263
Comment (tr|Q2S4F4|Q2S4F4_SALRD) Glycogen synthase {ECO:0000313|EMBL:ABC45653.1} KW=Complete proteome; Reference proteome OX=309807 OS=Salinibacter ruber (strain DSM 13855 / M31). GN=SRU_0791 OC=Rhodothermaceae; Salinibacter.
Sequence
MHMASSYRLLYVAEALAPFTEQSPLATLTRSLPEQVQEAGDFEVRIMMPCYGDINERKHS
LHEVIRLSDTDVPMGANTESVSVKVASVPDVQLQVYFMDHEGYFGRSGRATDGDGSAFDD
NADRALFFNRSVLETLRELRWGPDLIHGFGWISGLLPTLLSTTYADDDLLGATKSVFTPG
GQAPATTLEASFADTMNLPIDGNAGATLSEVGRTHADATILPPNGTSANGAQAEDVSRFQ
ADPQPRTEQTVALYDQMLGEVPA
Download sequence
Identical sequences D5H785 Q2S4F4
gi|83816146|ref|YP_444927.1| 309807.SRU_0791 gi|294506784|ref|YP_003570842.1| WP_011403556.1.91540 YP_444927.1.20240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]