SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2S5C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2S5C7
Domain Number 1 Region: 75-310
Classification Level Classification E-value
Superfamily PRTase-like 2.67e-39
Family Phosphoribosylpyrophosphate synthetase-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2S5C7
Sequence length 325
Comment (tr|Q2S5C7|Q2S5C7_SALRD) Ribose-phosphate pyrophosphokinase {ECO:0000313|EMBL:ABC45065.1} KW=Complete proteome; Reference proteome OX=309807 OS=Salinibacter ruber (strain DSM 13855 / M31). GN=SRU_0459 OC=Rhodothermaceae; Salinibacter.
Sequence
MPDDLRLFALSESRGFGEAIASALDTELDAHHERTFTDGEHEVRPEVNVRGRDVFVVQSL
YADDTWSVNDKLCRLLFMLGALRDASAERVTAVIPYLCYQRKDRKTRPRGPVTTRYVAGL
FEAVGVDRVLTMDVHNLAVLQNAFQARTEHLLGHPLFVHRLTDVVGAEEVAVVSPDEGGV
KRAGKFAEGLGAVLNCEVPTAFVEKMRKDDGVTGGALVGSVEDRTAIVVDDMVSTAGTMT
QAIRSCAEEGAESVYAVATHGLFVGEADERLETAPLDALFVTNTVAPRLTGAAAERLQIC
NAAPRFAAAIQAVHTETSVSALNEV
Download sequence
Identical sequences D5H601 Q2S5C7
gi|83815558|ref|YP_444604.1| gi|294506350|ref|YP_003570408.1| WP_011403237.1.91540 YP_444604.1.20240 309807.SRU_0459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]