SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2YCI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2YCI1
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.79e-31
Family Sfri0576-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2YCI1
Sequence length 114
Comment (tr|Q2YCI1|Q2YCI1_NITMU) SpoIIAA-like {ECO:0000313|EMBL:SEF81673.1} KW=Complete proteome; Reference proteome OX=323848 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71). GN=SAMN05216403_11059 OC=Nitrosomonadaceae; Nitrosospira.
Sequence
MITIEETENLISIAVFGEFTLADYQEFEDKVLRKAGREGKVNVLFDWRDMLSYTIDVAWE
DIKFVREHGSEFNRIAIITENQWRAWAAWVSNLFVDADIRVFRDYAAAKTWLEG
Download sequence
Identical sequences A0A1H3VU68 Q2YCI1
WP_011379594.1.10075 WP_011379594.1.92891 323848.Nmul_A0232 gi|82701366|ref|YP_410932.1| 372708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]