SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q30UF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q30UF4
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q30UF4
Sequence length 185
Comment (tr|Q30UF4|Q30UF4_SULDN) Pyruvate:acceptor oxidoreductase gamma subunit {ECO:0000313|EMBL:ABB43377.1} KW=Complete proteome; Reference proteome OX=326298 OS=(Thiomicrospira denitrificans (strain ATCC 33889 / DSM 1251)). GN=Suden_0096 OC=Helicobacteraceae; Sulfurimonas.
Sequence
MLEIRWHSRAGQGAVTGAKGLADVISTTGKHVQAFAFYGSAKRGAAMTAYNRVDDKVIMN
HEKYMKPDYVFVIDPALVFTSDVTINHKDSTKYIITTHLTTEELIKAQPKLEGKEVYTVD
CITIANETIGRPIPNTPMLGAFMKVSKMYDIEFFKESMQRILGKLPQKIIDANMFAIQRA
YDEVK
Download sequence
Identical sequences Q30UF4
326298.Suden_0096 WP_011371732.1.32152 gi|78776297|ref|YP_392612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]