SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q31MJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q31MJ5
Domain Number 1 Region: 35-497
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.31e-161
Family Type II DNA topoisomerase 0.00000000169
Further Details:      
 
Domain Number 2 Region: 588-848
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 5.75e-40
Family GyrA/ParC C-terminal domain-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q31MJ5
Sequence length 858
Comment (tr|Q31MJ5|Q31MJ5_SYNE7) DNA topoisomerase (ATP-hydrolyzing) {ECO:0000256|SAAS:SAAS00993483} KW=Complete proteome; Reference proteome OX=1140 OS=Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2). GN=Synpcc7942_1694 OC=Synechococcus.
Sequence
MTDSIQFNGADRILPTALHQEMQRSYLEYAMSVIVGRALPDARDGLKPVQRRILYAMHEL
GLTPDRPFRKSARVVGDVLGKYHPHGDQAVYDALVRLVQDFSSRYPLLAGHGNFGSIDND
PPAAMRYTETRLAPVSHVALLEEIGEETVDFVANFDNSQQEPSVLPAQLPFLLLNGCSGI
AVGMATNIPPHNLGEIVDALIALIDRPQLSDRDLLRYVPGPDFPTGGEVIGSQGILDAYL
EGRGSIPVRGIARIEEIQPGKGRHRRPVIIVTELPYQVSKAGWIEKVADLVNDGKLQGIA
DIRDESDREGMRVVIELRRDAQADKVLEQLYKRTALQSNFGAILLAIVEGQPQQLSLKQL
LEQFLSFREGTLRRRYGHELEQTERRLMILEGLLRSLSDLDGLIEILRQSPDGGTARARL
QVHFDLNERQADAVLSMPMRRITSLEQEQLQQEAANLREQQARLQTLLGDRPTLLKALKK
DLRDLKRRFGSPRRTRLPEIPPEAIAAPRQVTAPVAPISAPTPATAGPIQGELIFNSATD
SAVPDSAPVIAPRFAFQESTWLCLSDREQLQAASATELEPWLKAKSGAQERTDFPKVLQW
ADPRQDLLVITAEGRAYRRSLREVHPGPIANLLPTGRQSTAIAATLLLPLASEERSLLLL
SSQGRVKRLALTELAEISNRGLQLLKLAEEEIIQAACLCAPQQEVLLGSSGGRLLRLSLS
ELPLASRISRGQPRLLRLREGEQPLGCLSLPSGQDLLLVSTLGLVKRLPLGLLRLCRAGD
LGNNAFRFTDKRDRLIALLPAPSQGLAIFASDQRLWQRSISTIAVTGTDAEGQTLFNLRS
TETLQSATTLEGDRVTTV
Download sequence
Identical sequences Q31MJ5
gi|81300503|ref|YP_400711.1| 1140.Synpcc7942_1694 WP_011378145.1.45845 WP_011378145.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]