SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q31NT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q31NT4
Domain Number 1 Region: 9-387
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.28e-81
Family Cystathionine synthase-like 0.0000000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q31NT4
Sequence length 387
Comment (tr|Q31NT4|Q31NT4_SYNE7) L-cysteine/cystine lyase {ECO:0000313|EMBL:ABB57285.1} KW=Complete proteome; Reference proteome OX=1140 OS=Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2). GN=Synpcc7942_1255 OC=Synechococcus.
Sequence
MTRDRLLTHRQQFPALQNKAYFNYGGQGPLSTAALTAIQTAFADSQQLGPFSLATGQRVE
QISDRLRTDLAALLQTQSENITLTENVSVGCNIALWGVDWQAGDRLLITDCEHPSVIATA
QAIAQRFGVELDIWPLQAAVVAGQDLTEAFAAQLNSRTRLAAISHVLWNYGTVLPLAAIA
EQAHRQDCLLLVDGAQSVGLLPLDLPATGVDFYAFTGHKWLCGPEGVGGLYSRPESRATS
LPTWLGWRGVEKNTQGRPIRSKSDGRRYEIATSAYPLYAGLSAAIAQQADYGTIEDRYNR
SRQLAQWLWQSLQALPKVRCLATTLPQAGLISFQIDSSQSPFKIVSHLEGQGLQIRSLVG
PDCLRACCHYLTLETELESLVAAIAQI
Download sequence
Identical sequences A0A0H3K0B6 Q31NT4
gi|56750305|ref|YP_171006.1| gi|81300064|ref|YP_400272.1| 1140.Synpcc7942_1255 269084.syc0296_d WP_011242610.1.45845 WP_011242610.1.5740 WP_011242610.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]