SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q38V78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q38V78
Domain Number 1 Region: 10-225
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.62e-53
Family PP-loop ATPase 0.00014
Further Details:      
 
Domain Number 2 Region: 346-451
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000549
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q38V78
Sequence length 459
Comment (tr|Q38V78|Q38V78_LACSS) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=314315 OS=Lactobacillus sakei subsp. sakei (strain 23K). GN=LCA_1599 OC=Lactobacillus.
Sequence
MLERAFQNEIRCHQFWPTGAKVIVATSTGVDSMVLLTLLQRLPTALKPQLIVAHVNHELR
TESVAEEAYLRQFCLENDLSLQVAHWPLQQHPQTGIEAAAREFRYQFFEHLMTAEKADYL
VTAHHGDDQLETLMMKFIRSGELHEMRGIQSQRPFADGTLIRPLLPFAKQDLRDYALANN
ITSFEDQTNYETTVLRNRVRHTLVPFLKQENGQILQNANRFSQQLTALLGQQAQLATTLL
PLLDLKVTDKVISGQLKAIKTLPTAQQTAIWQLIIKQHFPQISPLKETQLQQLKQLIQST
VKPQGQLALGQRILFTKIYDRFQIGETTIGEIAAKDEKIRILMLNKWCVLPNNEQIGIFE
INHLPRKLSGQQLIWLADEQWPIVAKPCQLTDAIMIDKTHHKTLKRLFIDLKVPQEKRLN
SWGIWSQETLIGHPEFRVSALFIHEQTGKIRYVLCYANE
Download sequence
Identical sequences Q38V78
gi|81429211|ref|YP_396212.1| 314315.LSA1599 WP_011375292.1.13714 WP_011375292.1.42590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]