SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q39BL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q39BL3
Domain Number 1 Region: 21-123
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.11e-19
Family Ferredoxin domains from multidomain proteins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q39BL3
Sequence length 406
Comment (tr|Q39BL3|Q39BL3_BURL3) Uncharacterized protein {ECO:0000313|EMBL:ABB10148.1} KW=Complete proteome OX=482957 OS=9086 / R18194 / 383). GN=Bcep18194_B0031 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MQTNLSEASKALARADEAEAILRACVHCGFCNATCPTYQVLGNELDGPRGRIYLIKQLLE
GEPCGERTQQHLDRCLTCRNCETTCPSGVRYHTLLDIGRAEAEKRVQRPARERLLRAGLR
HVVPRPATFAALLKAGRALRPLLPGTLQDKIPAAVPAAAPRPPVRHARRVLMLEGCVQPS
LSPNTNAAAARVLDRLGISVTPAREAGCCGATEYHLNAQDAGLARARRNIDAWWPAIEAG
AEAIVLTASGCGAFVKEYGDLLRSDPVYAEKAQRVSALARDLAEVIAAEPLDALAGSTPR
RIGVHCPCTLQHAQRLGGAVERILTQLGFDLTNVADGHLCCGSAGTYSLTQPELATQLRD
NRLDALEAARPDLIVTANVGCQTHLNGAGRTAVRHWIELVDNHLVN
Download sequence
Identical sequences Q39BL3
gi|78060884|ref|YP_370792.1| WP_011353647.1.41686 269483.Bcep18194_B0031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]