SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q39EF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q39EF1
Domain Number 1 Region: 214-648
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.69e-93
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00015
Further Details:      
 
Domain Number 2 Region: 75-211
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.63e-36
Family Ferredoxin domains from multidomain proteins 0.00014
Further Details:      
 
Domain Number 3 Region: 1-74
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.35e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q39EF1
Sequence length 776
Comment (tr|Q39EF1|Q39EF1_BURL3) NADH-quinone oxidoreductase {ECO:0000256|RuleBase:RU003525} KW=Complete proteome OX=482957 OS=9086 / R18194 / 383). GN=Bcep18194_A5571 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MVELEIDGKKVEVPEGSMVIQAAHKADKYIPHFCYHKKLSVAANCRMCLVEVEKMPKAVP
ACATPVSAGMIVHTQSDKAVKAQQSVMEFLLINHPLDCPICDQGGECQLQDLAVGYGKSS
SRYSEEKRVVFHKNVGPLISMEEMSRCIHCTRCVRFGQEIAGVMEFGMLGRGEHSEITTF
VGKTVDSEMSGNMIDLCPVGALTSKPFRYSARTWELSRRKSVSPHDSVGANLVVQVKNNR
VMRVLPFENEAINECWISDKDRFSYEGLNSEERLTKPMLKQGGQWIETDWQTALEYVAKG
LKGIAADHGANALAMLASAHSTAEELFLVKQLANELKTPNVDFRLRQQDFSAPVQGAPWL
GMPIADLSNVDAAFVVGSFLRRDHPLFASRLRQAAKNGAKLHFLHATGDDALIPTAQRIV
AAPSAWLDQLAGIAAAVAQLRGVALPDALAGVTASPAAQAVAQSLANGERRAVLLGNVAV
RHPEFAKLHAVAKWIADNTGATFGFLTEAANTVGAHVVGALPGEGGLNAREAFEQPRKGY
VLLNVEPEFDTADPAQALAALNQAEMVVVMSPFKHGLDYADVLLPVAPFTETAGTYVNAE
GTVQSFNGVVRPLGDTRPGWKVLRVLGSVLGLPNFEYETSEEVRLAALGDAGVAGRLSNQ
TSVAPVRVAANAANGGFERLADVPIYHADALVRRAGALHLTTAAKAANAAALPAALFDKL
GLKEGDAVRVRQGERAVQLPAVRDANLAETVVRVSAATPAGAALGSLSGELVVEKA
Download sequence
Identical sequences Q39EF1
WP_011352697.1.41686 gi|78067040|ref|YP_369809.1| 269483.Bcep18194_A5571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]