SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q39HK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q39HK0
Domain Number 1 Region: 72-148
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.57e-31
Family CO dehydrogenase ISP C-domain like 0.00057
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.7e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q39HK0
Sequence length 153
Comment (tr|Q39HK0|Q39HK0_BURL3) Ferredoxin/oxidoreductase {ECO:0000313|EMBL:ABB08066.1} KW=Complete proteome OX=482957 OS=9086 / R18194 / 383). GN=Bcep18194_A4470 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MITLTVNGSEQHFDGNPDMPLLWYLRDVLGHTGTKFGCGMALCGACTVHLDGVAIRSCIT
PVAAASGKRVTTIEGLSTDLDHPLQQAWQELNVAQCGYCQSGQIMQAASLLKTNPHPTDA
DIDDAMSGNICRCGTYTRIRAAIRLAVRRGGAA
Download sequence
Identical sequences Q39HK0
WP_011351636.1.41686 269483.Bcep18194_A4470 gi|78065941|ref|YP_368710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]