SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q39I44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q39I44
Domain Number 1 Region: 144-419
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.13e-84
Family D-glucarate dehydratase-like 0.000000000746
Further Details:      
 
Domain Number 2 Region: 12-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.43e-33
Family Enolase N-terminal domain-like 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q39I44
Sequence length 450
Comment (tr|Q39I44|Q39I44_BURL3) D-glucarate dehydratase {ECO:0000313|EMBL:ABB07872.1} KW=Complete proteome OX=482957 OS=9086 / R18194 / 383). GN=Bcep18194_A4275 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MNAVTASPSHDTPRIVDLQAIPVAGHDSMLLNLSGAHGPFFTRNLVILKDSAGRTGVGEV
PGGESIRRTLDDARALVVGQPVGNYHAVLNDVRRTFADRDASGRGLQTFDLRTTIHAVTA
LEAALLDLLGQHLGVPVAALLGEGQQRERVEMLGYLFYIGDRTRTALAYRDGSGATDDWT
RVRDEAALTPEAVVRLAEAAHARYGFNDFKLKGGVFEGASEIEAVTALAERFPDARVTLD
PNGAWSLDEAVRLCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRATGLPTATNMIATDW
RQMGHAVQLQAVDIPLADPHFWTMQGSVRVAQMCRDWGLTWGSHSNNHFDVSLAMFTHVA
AAAPGQVTAIDTHWIWQDGERLTREPLKIENGLVEVPKRPGLGIDIDMDAVAVAHELYKQ
HGLGARDDAAAMQYLIPGWTFNNKRPCLVR
Download sequence
Identical sequences Q39I44
269483.Bcep18194_A4275 gi|78065747|ref|YP_368516.1| WP_011351443.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]