SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q39N47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q39N47
Domain Number 1 Region: 101-227
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-28
Family Aromatic dioxygenase reductase-like 0.0048
Further Details:      
 
Domain Number 2 Region: 213-319
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.97e-27
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0059
Further Details:      
 
Domain Number 3 Region: 3-103
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.49e-19
Family Ferredoxin reductase FAD-binding domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q39N47
Sequence length 319
Comment (tr|Q39N47|Q39N47_BURL3) Ferredoxin/Oxidoreductase FAD/NAD(P)-binding protein {ECO:0000313|EMBL:ABB06119.1} KW=Complete proteome OX=482957 OS=9086 / R18194 / 383). GN=Bcep18194_C7074 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MSLLRIRVARIEALTPAIRRLHLVASNGAPLPGFDAGAHIGVHVPLSPRPPRRAYSLVNA
DAGAACVDHYEIAVLREAAGSGGSQWMHACVPGDEFDVDPPRNDFPLATNAQRHLLIAGG
IGITPILSMARELTRAGRAFTLHYAARDAASMAYRDEVAALPDATCWFDNGDPARGMPLA
DTIGAPEPGTHLYVCGPTGLIEATLAVARRLGWRDDALHSERFAAAVPSGSDAPFEVRLA
TSGRVLNVPAGASILDTLIEAGLDPLYDCRRGDCGVCTVRLLDGEPDHRDICLTDEEHAG
GSFCPCVSRAKSAGLVLDL
Download sequence
Identical sequences Q39N47
269483.Bcep18194_C7074 gi|78060188|ref|YP_366763.1| WP_011349762.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]