SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3AC24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3AC24
Domain Number 1 Region: 3-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-81
Family Protein kinases, catalytic subunit 0.00000149
Further Details:      
 
Domain Number 2 Region: 469-531
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000576
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 399-461
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000903
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3AC24
Sequence length 610
Comment (tr|Q3AC24|Q3AC24_CARHZ) Putative serine/threonine protein kinase {ECO:0000313|EMBL:ABB13855.1} KW=Complete proteome; Reference proteome OX=246194 OS=Z-2901). GN=CHY_1478 OC=Thermoanaerobacteraceae; Carboxydothermus.
Sequence
MIGRVLAGRYKILETLGGGGMAVVYKGQDLLLNRYITIKILRPEFTSDEEFVERFKREAK
ALASLSHPNIVNIYDVGQEENTYFLVMEYVEGKNLKEIIREKNLGLRESVRIVLQVALAL
GHAHQHGILHRDVKPQNIIITPEGIAKLTDFGIAGNVTSSTINKDKEILGSVHYLSPEQA
KGENLTFASDLYSLGVVFYELVTKRLPFTGDSPIAVALKQINDLPKPPSSYNKNIPDELD
RIILKLLSKKPEQRYKSAYELIATLKKLDLPEENFAEDSTMTIILDKNQFPEVRGKKRLK
TSGIIALVALFLALIGGLGYFLYNYFNVKEAVIPEVRGLGIGEAKQKLEELGFTNINISS
AYHETVPKDKVISIDPLPGERVKVARPIYLVVSKGKEMVLVPDVREKDIHDARVILENAG
LKVGEINEIYDERLAPGTVIEQDPEPNTEVEKGYKIKLILSKGAKPAWITVPDLRGKQIE
EARKTLQQVKLVLDDTIKEVDSTEYFAGQVVTQNPLPGSLVEEGSKVRITVSRGPGPVRK
SVLVTLAVPNDGQKHSVKIVVKDARTSEVIVYANDSEEPGTVLEKEVYYYGKGRIKVYLD
DVVIEDKEVN
Download sequence
Identical sequences Q3AC24
WP_011344385.1.931 gi|78042841|ref|YP_360310.1| 246194.CHY_1478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]