SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3B3B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3B3B5
Domain Number 1 Region: 44-205
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.45e-26
Family Clp protease, ClpP subunit 0.06
Further Details:      
 
Domain Number 2 Region: 377-442
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000222
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3B3B5
Sequence length 443
Comment (tr|Q3B3B5|Q3B3B5_CHLL7) Nodulation efficiency protein NfeD {ECO:0000313|EMBL:ABB24166.1} KW=Complete proteome; Reference proteome OX=319225 OS=Chlorobium luteolum (strain DSM 273 / 2530) (Pelodictyon luteolum). GN=Plut_1306 OC=Chlorobium/Pelodictyon group; Pelodictyon.
Sequence
MEMRALPFRIPGFGVALVMVVMLLFFQSLHAAESVPVERLVTGMVLRGPVNPGSARYFSR
VLDEASLEGSGAVLVELDTPGGLVSSLRTMVKAVMASPVPVIVYVSPSGAEAASAGALLL
LSAHVAAMSPGTETGAAHPVTPGIPGQGESAAGTKAVNDLAAFARSLALERGRNPEWAER
AVRESLASSASEALQEGVIDIIADTPKELLRRTDGRQLKTAAGIQTLSTAGARLVMKPPS
FSESVLMAVAHPDIAYILFLAGLLGLYFEFASPGAIFPGTAGAVALLLGLYSLQLLSASI
TGILLLMLAVLFLAMEVFVTSGGVLAVAGLVSLFAGSLMLFDFPSSGLTLSLQVFLPVFI
AFSLAVVLILRLIVRSARGRKLSGGEGLVGETGEALEPLAPGVPGKVFVHGELWDAVSAS
AVEKGGGVRVEGMKGMQLQVNRQ
Download sequence
Identical sequences Q3B3B5
gi|78187166|ref|YP_375209.1| 319225.Plut_1306 WP_011358038.1.73161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]