SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3HKG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3HKG0
Domain Number 1 Region: 398-485
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000608
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3HKG0
Sequence length 496
Comment (tr|Q3HKG0|Q3HKG0_RHOS4) Antisigma-factor antagonist STAS {ECO:0000313|EMBL:ABA81784.1} KW=Complete proteome; Reference proteome OX=272943 OS=158). GN=RSP_4257 OC=Rhodobacteraceae; Rhodobacter.
Sequence
MISFATYRQQWLGHVRGDLLSGLVVALALIPEAIAFSIIAGVDPKVGLYASFSIAVVTAI
AGGRPGMISAATAATAVLMVTLVRDHGLQYLLAATVLAGLIQIALGLLKLGFVMRYVSRS
VMTGFVNALAILIFLAQLPELDPRAVPPLTYLLVAAGLAIIYLFPRLTRAVPSPLVTIIV
LTALTLGLGLDVRTVGDMGALPDTLPVFLIPDIPLTFETLRIILPPATAVAVVGLLESLM
TQTLVDELTDTRSSRNQECIGQGLANAATGFIGGMAGCAMIGQSMINVKSGGRGRLSCFV
AGVFLLILVVGLGDVVSRIPMAALVAIMIMVSIGTFSWSSLKALRTHPRSSSVVMLATVA
TVVWTHNLALGVLVGVLLSGIFFAAKIAQLFAVSSELSACGRARTYRVEGQLFYGSVEDF
MAAFDFREPLERVTIDVSRAHIWDISSVQALDMAVLKFRREGAEVRIVGMNEASETLVDR
LALHDRPGALDRLTAH
Download sequence
Identical sequences Q3HKG0
272943.RSP_4257 gi|125654696|ref|YP_001033889.1| WP_011836248.1.22285 WP_011836248.1.62547 WP_011836248.1.80699 WP_011836248.1.8565 YP_001033889.1.90827 APC63695 gi|125654696|ref|YP_001033889.1|NC_009008 gi|500161578|ref|WP_011836248.1|NZ_AKBU01000003 gi|500161578|ref|WP_011836248.1|NZ_AKVW01000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]