SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3IM01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3IM01
Domain Number 1 Region: 85-255
Classification Level Classification E-value
Superfamily GAF domain-like 1.57e-42
Family IclR ligand-binding domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 17-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000342
Family Transcriptional regulator IclR, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3IM01
Sequence length 256
Comment (tr|Q3IM01|Q3IM01_NATPD) IclR family transcription regulator {ECO:0000313|EMBL:CAI50868.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_6176A OC=Natronomonas.
Sequence
MVSEPDNDGGIKSAGTSFGIIETIYQNQPISLTELAAEVDIANSTAYEHISTLLDSGYIV
KRADGYYLSLKFLDRGTKAKEYYQELLDVSEPALEQLVDETDEAVNLVVEEHGQAVYIDR
RTGERGVPTNSWVGKRKPLHTLSAGKAILSQLPEERVDEILDARGLSVSTERAITTREEL
YDELEEIRQNGVSFNDRESHSQIRAVGAPIVVDDRVYGAVSVAGPAMRLTGEYFRQEIAD
LLQGAVNEIELKLTYH
Download sequence
Identical sequences Q3IM01
WP_011324466.1.57290 348780.NP6176A gi|76803445|ref|YP_327714.1|NC_007427 gi|76803445|ref|YP_327714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]