SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3IQZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3IQZ0
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.4e-38
Family Pyruvate oxidase and decarboxylase Pyr module 0.0023
Further Details:      
 
Domain Number 2 Region: 403-572
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.43e-24
Family Pyruvate oxidase and decarboxylase PP module 0.0052
Further Details:      
 
Domain Number 3 Region: 167-177,224-376
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0000000244
Family Pyruvate oxidase and decarboxylase, middle domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3IQZ0
Sequence length 586
Comment (sp|Q3IQZ0|MEND_NATPD) Menaquinone biosynthesis protein MenD {ECO:0000255|HAMAP-Rule:MF_01659} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_2726A; OC=Natronomonas.
Sequence
MATPNVNTLWGQTVADELATVGIETAVLAPGSRSTPLAVAFAQHDDIEAVSLLDERSAAF
FALGYAKRTGQPAPLVCTSGTALANFHPAVIEADTARVPMVLLTADRPPELADSGANQTI
DQADLYGDAVRSYRTLPEPEAAARKLRSLRTTLCRAVGTATGTEPGPVHLNVPFRKPLEP
LAAAEPPAGVPDGAVPDGFATENPLAARGRDGPFVEVHSGCTDPSATTVDELATAVEAAA
SGLIVCGPTDRPAPDAESLVALADATGFSVFADPLSGLRFGPHVDDAPVCGGYDAYLPAL
EQTPEVVIRFGASPTSKPLRQYLRDADARQFIVDPAGGWREATFTATDLVVADETRLATA
VADAVDRTPGSYADRLAELEPGYWRLVEGEEPQEGAMLADAVALAPDPSTVFVSNSMPVR
DLDRFGAPQAASLSVLGNRGASGIDGIASTALGAGFGTDDPLVAVTGDLAYYHDMNGLLA
VSRAGVDATIVCINNDGGGIFHVLPIEAHESFDKWFRTPHGLDFEPSAALYDIEFARTDS
REGFRSLYSEAVGSGETQVIEVQTESGHNHADRTALREAVVEELGR
Download sequence
Identical sequences Q3IQZ0
gi|76802005|ref|YP_327013.1| WP_011323079.1.57290 348780.NP2726A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]