SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3K4Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3K4Z9
Domain Number 1 Region: 56-275
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.06e-45
Family Phosphate binding protein-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3K4Z9
Sequence length 356
Comment (tr|Q3K4Z9|Q3K4Z9_PSEPF) Taurine transport system substrate-binding protein {ECO:0000313|EMBL:ABA77155.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_5418 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MVFISLFLDRLALTQPRFVNPYQKGDAMMAKRALSSQFVTVCVSALISFSAHAANLTVGY
QTGIDPSKVPQADGVYEKTIGEKIDWRRFNSGPEVVTAIASGDVQIGNLGSSPLAAAASR
NLPIVAFIVSAQINAAEALVVRNGSGINKPEDLIGKTIATPFVSTSHYSLLGALKHWALD
TSKVKVVNLQPAEIAAAWKRGDIDGAFVWSPALGEIRKTGKTLTDAAQVGQWGAPTFEVW
VARKDFAEKHPEVVAKFAKVTLDSFADYAAHKDSWTADSVPVQKIAKLTGANAADVPELL
AGSAFPDAQAQQTTALLDGGTAKAIGETAKFLKEQGKVESVLPDYSPYVSAKFVAE
Download sequence
Identical sequences Q3K4Z9
gi|77461639|ref|YP_351146.1| 205922.Pfl01_5418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]