SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3K513 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3K513
Domain Number 1 Region: 37-374
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.14e-101
Family Phosphate binding protein-like 0.00000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3K513
Sequence length 375
Comment (tr|Q3K513|Q3K513_PSEPF) Putrescine ABC transport system, substrate-binding periplasmic protein {ECO:0000313|EMBL:ABA77141.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_5404 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MGPTKSEDLHLPIFSSLRNALLAAAGLTFAVGAQAAGTVHIYNWSDYIGETTLADFQKET
GIKPVYDVFDSNETLEGKLLAGRTGYDVVVPSNHFLGKQIKAGAFQKLDKAQLPNYSNLD
PVLLKRLEQNDPGNLYAVPYLWGTNGIGYNVDKVKAVLGVDKIDSWSVLFEPENIKKLHS
CGVAFLDSADEMMPTVLNYMGLNANSTNPKDYEKATAKLLAVRPYVTYFHSSKYIGDLAN
GDICVAIGFSGDIFQAKNRAEEAKKGVNIAYSIPKEGGALWFDMLAIPKDSANVKEAHAF
INYLLKPEVIAQVSDYVGYANPNPGSDKLMEQSIRTDESVYPPQAVLDKTYVSIELPPNI
QRLMTRSWTKVKSGK
Download sequence
Identical sequences Q3K513
205922.Pfl01_5404 gi|77461625|ref|YP_351132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]