SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3K780 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3K780
Domain Number 1 Region: 88-300
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.7e-49
Family Phosphate binding protein-like 0.0074
Further Details:      
 
Domain Number 2 Region: 8-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-16
Family LysR-like transcriptional regulators 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3K780
Sequence length 301
Comment (tr|Q3K780|Q3K780_PSEPF) Putative LysR-family regulatory protein {ECO:0000313|EMBL:ABA76374.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_4637 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MDLFQSMSVYVKVVESGSMTAAALQCEMSTTMVGNHLRALEQRLGVQLLQRTTRRQRLTE
FGSVYYQRCLEVLGLVADSERLAEQTLDEPRGILRVTAPLTFGVERLAPALSEFSLQCPQ
VKLDVILTNRRPDLLESGLDVAFRLGHFDQSNLIARPLIDYTLTVCASPEYVARRGMPLT
PEELRQHDCLSFAYPAGDDWQSVEKQWRLSGPDGEIMVDVKGPMLINSSAGLHQAARTGM
GIVMLPDALVEQDLRDGRLVVVMPDYQPPNRPMHLLYAPDRYRLPKLRRFVEFALQMWGR
P
Download sequence
Identical sequences Q3K780
WP_011335835.1.2668 gi|77460858|ref|YP_350365.1| 205922.Pfl01_4637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]