SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3K829 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3K829
Domain Number 1 Region: 91-288
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-26
Family Phosphate binding protein-like 0.0079
Further Details:      
 
Domain Number 2 Region: 5-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.29e-17
Family LysR-like transcriptional regulators 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3K829
Sequence length 290
Comment (tr|Q3K829|Q3K829_PSEPF) Putative LysR-family transcriptional regulator {ECO:0000313|EMBL:ABA76075.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_4338 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNFNSESIELFLAVIERGSFSAAARALGKVPSAVSMAIGNLEAELGYALFDRSHREPQPT
AMALSLVPHARLIADQLKQLQVHAVQLSLGLESKLSIGVAADIDRRRLLAAIKDLSERHP
LLDIEVLTAPQDDVLAMLHSGRVSVCLAFAGLSVNVLERFQFVGSERMIATLAADSPLLQ
GQDLFLEDLVHVRQIVVGSRDLPISETRPLVAESHWRTDNLETALEMVETGLGWGNFPLS
VVQPWLDSGRLKRLNFRNIENGLVLPVHAVWLKSQPLQKGALALVELLGG
Download sequence
Identical sequences Q3K829
205922.Pfl01_4338 gi|77460559|ref|YP_350066.1| WP_011335584.1.2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]