SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3KAN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3KAN9
Domain Number 1 Region: 93-278
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.99e-25
Family Phosphate binding protein-like 0.015
Further Details:      
 
Domain Number 2 Region: 8-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.3e-20
Family LysR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3KAN9
Sequence length 296
Comment (tr|Q3KAN9|Q3KAN9_PSEPF) LysR family regulatory protein {ECO:0000313|EMBL:ABA75165.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_3427 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MYKRYPSVQSMSAFIHAARSGSFSSAARKLDLTHSAISQQIRALEDFIGQPLFVREGGGS
NLTDAGQLFASVLSDGLAQIDRALSSVKNRSVAQRLTLDVDSELAQSWLNPRLPQLLDGL
PDYEVTILSMPRSDRSTLERVNLLLRYGYGDWDDCEMTQICGDRVLAVASPALLERHGLQ
VPLSPAQILELPLLGYTRRSWIPWLDAAGMTPTEPPARVIFDNAANLIAAAEAGVGAGLV
RGLLAADALRSGRLVALNQAQIAAHYNLYAVWPHGQAERVAPVVEVIQQLAMQTLH
Download sequence
Identical sequences Q3KAN9
gi|77459649|ref|YP_349156.1| WP_011334797.1.2668 205922.Pfl01_3427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]