SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3KCX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3KCX4
Domain Number 1 Region: 25-408
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.19e-78
Family Phosphate binding protein-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3KCX4
Sequence length 436
Comment (tr|Q3KCX4|Q3KCX4_PSEPF) Sorbitol-binding protein / mannitol-binding protein {ECO:0000313|EMBL:ABA74381.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_2640 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MQPTAKALLALTCMTLSSVSLGAQTLTIATVNNSDMIRMQKLSKTFETEHPDIKLNWVVL
EENVLRQRLTTDIATQGGQFDVLTIGMYEAALWGAKGWLEPMKDLPASYALDDVFPSVRE
GLSVKGSLYALPFYAESSITYYRTDLFKDAGLTMPERPTWEQIAGFAEKLTNKDKEQYGI
CLRGKAGWGENMALITTVANAYGARWFDEQWKPEFSGPEWKNALNFYVDTMKKSGPPGAS
SNGFNENLALFNSGKCAIWVDASVAGSFVTDKTQSKVADHVGFTYAPHQVTDKGSAWLYS
WALAIPTSSKAKDAAKQFSAWATSKEYGELVAKTDGIANVPPGTRASTYSDAYMSAAPFA
KVTLESLKAADPSKPTFKPVPYIGIQLVTIPEFQGIGTQVGKLFSAALIGQTTVDQALTA
AQQTTEREMKRAGYPK
Download sequence
Identical sequences Q3KCX4
gi|77458865|ref|YP_348371.1| WP_011334054.1.2668 205922.Pfl01_2640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]