SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3KDF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3KDF4
Domain Number 1 Region: 93-293
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.71e-30
Family Phosphate binding protein-like 0.00024
Further Details:      
 
Domain Number 2 Region: 7-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000748
Family LysR-like transcriptional regulators 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3KDF4
Sequence length 324
Comment (tr|Q3KDF4|Q3KDF4_PSEPF) Putative LysR family transcriptional regulator {ECO:0000313|EMBL:ABA74201.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_2460 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNRNELRRVDINLLVVFETLMHERNVSRVGEKLFLGQPTISAALGRLRVLFDDPLFVRAG
RVMEPTRRAEEIFANLTPALDGVVAALSRCQPFAPATSEVTFQVGLSDDVEYALLPRLLR
QLRSEAPNIALVVLRVDQQQMSQRLFNGEISLGISPTLDLPANARRKSLRSIRPMLLRSD
TRPGLLALDEFCERPHAIVSSMGKARDDTDHALDLLGRRRKVVLAVPQFSALPRLLAQSD
MLVIVPDYVARAMASVNGIRAEPAPLLLPSRELSMVWRAAAHNDCAQRWLRSRCQAFLGT
PIELQVVPKLRPALPVDQTLMMAR
Download sequence
Identical sequences Q3KDF4
205922.Pfl01_2460 gi|77458685|ref|YP_348191.1| WP_011333882.1.2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]