SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3KDQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3KDQ1
Domain Number 1 Region: 83-289
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.76e-46
Family Phosphate binding protein-like 0.013
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.46e-21
Family LysR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3KDQ1
Sequence length 301
Comment (tr|Q3KDQ1|Q3KDQ1_PSEPF) Putative LysR family transcriptional regulator {ECO:0000313|EMBL:ABA74105.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_2362 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MQSFVMVVDTGSITEAARQLGTAKSMVSQRIAQLEKRLGSIVLERGRQARLTEAGEVFYR
YCVRILSEVEEAEDAVLAFQSSLRGSLRLAAPMAFSIRYLTPILSSFAVRYPELRLDIEF
DDRHVNLHEERYDAAIRIGELPDSSLVAKTITANRHIICASPDYLAAHGTPQTPQELSEH
FAMLYVNREPHGMWTLPVNNALESFRVRCRMRTNNGHQLMEAAKAGMGLAILPTFLAAQA
IVDGELQEVLAPYAPRGGNISAVYRRSQRASPKLQALTDFLCEQIGNPPVWEQLLGAHSA
G
Download sequence
Identical sequences Q3KDQ1
205922.Pfl01_2362 gi|77458589|ref|YP_348094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]