SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3KE73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3KE73
Domain Number 1 Region: 90-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-31
Family Phosphate binding protein-like 0.0051
Further Details:      
 
Domain Number 2 Region: 1-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000871
Family LysR-like transcriptional regulators 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3KE73
Sequence length 297
Comment (tr|Q3KE73|Q3KE73_PSEPF) Putative LysR-family transcriptional regulator {ECO:0000313|EMBL:ABA73933.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_2190 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MRLRHIEVIQALLQTGHVGTAAEWLQLPAPEVEERLREAESQLGFMLFASVRGRLQPTPE
ARALQVEIGHIYEALEPVQRLASSLKQYLAPPLRIIGTPPLAQQLLPQSLAALRRCLPDV
PCTLLSEPTRDIVRHLLLRDSDLGLSLHDPQHPDIDCQPLAQGKLQLLAPHGWLQPKQKY
ISLQDLAGQAMVGLEGQDPLSPALENKLQALRPAPTIQTRVQTHQMMRSMVEAGEGLAIV
DPFTALGARAGGLDVCPLSPAVPISLYALTFKHATPSAAIQTLLGIVTEQAEAMLAN
Download sequence
Identical sequences Q3KE73
205922.Pfl01_2190 gi|77458417|ref|YP_347922.1| WP_011333619.1.2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]