SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3KI50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3KI50
Domain Number 1 Region: 26-528
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.43e-144
Family Phosphate binding protein-like 0.000000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3KI50
Sequence length 531
Comment (tr|Q3KI50|Q3KI50_PSEPF) Dipeptide ABC transport system, substrate-binding protein {ECO:0000313|EMBL:ABA72556.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_0813 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKMLPLRAAIAAALLSVAVGVSAKPLVVCTEASPEGFDMVQYTTAVTADAVAETIFNRLA
DFKPGTTEVIPALAESWDISEDGLTYTFHLRKGVKFHTTEYFKPTRDMNADDVVWSFQRQ
LDPNHPWHKLSSVGFPYFESMGFKELLKSVEKVDDNTVKFTLTRREAPFLADIAMAFSSI
YPAEYADQLLKANKTGDLNNKPVGTGPFIFQRYAKDAQVRFKANPDYFRGKAPADALILA
IATDNNVRLQKLKANECQIALYPKPDDIPSIKKDSNLKVDELDAMTVSYVAMNTQHKYIS
DVRVRKAIDIAFDKEAYVNALFGKGNASVAVNPYPPTLLGYNHELKNPPRDLDKARALLK
EAGVPEGTTFTLFTRNGGGPTNPNPMLGAQMMQADLAKVGIKIDIRVMEWGEMLKRAKAG
EHDMVSAGWAGDNGDPDNFLTPMLSCEAAKNGENYARWCNEKFQALLDEARAKVDPAERA
KLYEEAQVIFNQDQPWISMAHTRMFTAMRNNVEGYHISPLTTNNFATTQVK
Download sequence
Identical sequences Q3KI50
gi|77457040|ref|YP_346545.1| 205922.Pfl01_0813 WP_011332435.1.2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]