SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3KJV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3KJV1
Domain Number 1 Region: 32-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.71e-41
Family Phosphate binding protein-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3KJV1
Sequence length 337
Comment (tr|Q3KJV1|Q3KJV1_PSEPF) Putative ABC sulfu transport system, substrate-binding protein {ECO:0000313|EMBL:ABA71955.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_0211 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNLPFKRVISLFAAPALAGLLAFSAQADELKEIRIAVPDLSAGTQHSGGGIVDVLRDQQI
FEKAFADQGIKIQWSFFKGAGPVINEAFANGQVDLAYLGDLAAIIGKSNGLDTRLLSASA
RGVKQYLGVVPGSGIKTLQDLKGKRVAIFRGTATQLSFDAALASVGLSEKDVKVINLDFN
AAVAALAAKQIDASWGSSGLTALQAKGLAELPLNTKDLGGAGSVQSVLVGTGKFVDGHPE
AVAKLLKAQQQAVEWLTQDSNKDAYVQLVSGLASYPPVILTQDLKDQNLSEVFPSTLDPL
FLENLQGKVDLAAQQKLIRKPFKVNEWVAPELAAAKL
Download sequence
Identical sequences A0A2A5R566 A0A2K4HUA6 Q3KJV1
WP_011331920.1.15864 WP_011331920.1.22023 WP_011331920.1.2668 WP_011331920.1.30523 WP_011331920.1.32803 WP_011331920.1.46399 WP_011331920.1.47897 WP_011331920.1.53106 WP_011331920.1.58965 WP_011331920.1.96080 gi|77456439|ref|YP_345944.1| 205922.Pfl01_0211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]