SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3M267 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q3M267
Domain Number - Region: 252-320
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000876
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 
Domain Number - Region: 50-119
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0942
Family Galacturonase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3M267
Sequence length 581
Comment (tr|Q3M267|Q3M267_ANAVT) Potassium-translocating ATPase A chain {ECO:0000256|HAMAP-Rule:MF_00275} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_B0207 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MLQGWLQIVLTLLIVVAITPFFGRYMARVYQEQRTLLDPILNPVERLVYSLIGVATKENM
TGWQYARAILYSNIVMGLLIFFIIMNQGWLPFNPTKIGAPTWDTALHTTISFITNTNQQH
YSGETYLSYASQMWGLGYHMFTSAATGLAVGIAFIRGLTGRPLGNFYVDLTRSITRVLLP
ICIVGGIALMAAGVPETLAGPVVFPTLEDPNISQAIARGPVAHFEIIKQLGENGGGFFAI
NSAHPFENPNGFSNLILIVAMISIPTSLIYTYGLFANNTKQAWLVYGMVGVIYVTFIIIT
AIGEYNGNPAVNALLGSTQPNLEGKEVRFGWAQSALFAVTTTGTMCGAVNSLHDSFMPNG
GFVTLSNMFLQIIWGGQGTGTAYLFAYLILAVFATGLMVGRTPEFLGRKIEKREVVLASF
LILLVHPIAIMIPAGIALAFPDQLAGISNPGFHGLSQVIYEYASAAANNGSGFEGLGDSQ
PSPIAIATGATTTTTALWWNLSACFSLLAGRYIPIIGLLLLADSLSRKQQVPFTAGTLRT
DTGLFTGVTAGVILILGALTFFPVLAFGPIGEAFWIARGIG
Download sequence
Identical sequences A0A1W5CAG6 Q3M267
240292.Ava_B0207 gi|75812489|ref|YP_320108.1|NC_007410 gi|75812489|ref|YP_320108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]