SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3M694 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M694
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.48e-56
Family ADP-ribosylglycohydrolase 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3M694
Sequence length 262
Comment (tr|Q3M694|Q3M694_ANAVT) ADP-ribosylation/Crystallin J1 {ECO:0000313|EMBL:ABA23492.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_3887 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MLGAIAGDIIGSVYEGNSIKTKDFPLFSRQSRFTDDTVLTVAVADVILNTDQFPQSSKYI
DQFKWYYRRYLYAGYGRNFSNWAKSNSTQPYNSFGNGAAMRVSPIAFAFPDLNTVLQQAK
GSAEVTHNHPEGIKGAQATASAIFLARTGWDKAEIKSYIQDNFGYNLEQTLEQIRPTYQY
DATCPGSVPPAIIAFLESSDFEDAIRNAVSLGGDSDTIACITGAIAQAYYGGVPRAIAEQ
TLSHLNEHLCTTTEKFMYKYCL
Download sequence
Identical sequences A0A1W5CM79 Q3M694
gi|75910091|ref|YP_324387.1| 240292.Ava_3887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]