SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3M8G0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M8G0
Domain Number 1 Region: 14-410
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 5.23e-139
Family ArgJ-like 0.000000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3M8G0
Sequence length 413
Comment (tr|Q3M8G0|Q3M8G0_ANAVT) Arginine biosynthesis bifunctional protein ArgJ beta chain {ECO:0000256|HAMAP-Rule:MF_01106} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_3118 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MADWQEITGGITAPKGYRAAGITAGLKPSGLPDLALIVSDVEAIAAGVFTTSQVKAACVD
YCRQRLQAKQSARAILCNAGQANAATGSQGIKDAEESADLLAKELNISPESILLASTGVI
GQRIKMDALRNGIPKLVASLTDAGSDAAAGAIITTDLVTKSIALETTIGDRPVRIGGIAK
GSGMIHPNMATMLAFVTCDAAVSPHLWQQMLTRAADRSFNSITVDGDTSTNDSLIALANG
QSRTPAITEVGAESEKLEAMLTAVCQHLAKAITRDGEGATCLIEVQVTGAHDEQAARQIA
KTIAGSSLVKSAIFGRDPNWGRIAAAAGRAGVPFEQENLQIQLGDFLLLDNGQPLPFDRA
AASAYLKQAATGAYLQQDTVLISVNVGNGHGTGKAWGCDLSYDYVKINAEYTT
Download sequence
Identical sequences A0A1W5CJN2 Q3M8G0
gi|75909325|ref|YP_323621.1| 240292.Ava_3118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]