SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3MBE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MBE4
Domain Number 1 Region: 18-121
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-25
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3MBE4
Sequence length 133
Comment (tr|Q3MBE4|Q3MBE4_ANAVT) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_2070 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MSFLAFVELAIYLVKFMTLTQEPQVVLFKPQGSIDLQGGLALTEQMTQAGSQPHQLWVLD
LAEVDFMDSSGLVSLVKGLTSARQLGCRLILCNVQTPVRLILELTQLDSVFEIFDSYEEI
LTLVNDSSFALVS
Download sequence
Identical sequences A0A1W5CHC7 Q3MBE4
gi|75908291|ref|YP_322587.1| 240292.Ava_2070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]