SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3MDD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q3MDD2
Domain Number - Region: 171-214
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 0.011
Family Argininosuccinate synthetase, C-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3MDD2
Sequence length 313
Comment (tr|Q3MDD2|Q3MDD2_ANAVT) O-antigen polymerase {ECO:0000313|EMBL:ABA21004.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_1380 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MRYSIREQMRLIALALGVATLLSLFFSTFLPDYIHKAPELAGMWSGIYGHKNELGYMMAW
SAGIFLHLALSNYQYTWLMWTLCGVATSLIILSRSTTSLTILLTIILILPFYRFFKKTNY
KLQVIMIGLALILLTLSTILLMTNIENIVGTSGKDLTFNGRADLWEPIISKVWERPWFGY
GYYGFWNSPEAANVRATYEWASNSHNGFLELLLDIGFLGFLVFAAGFIRFFVLALGRIIS
VAKKPEDYWPMQMLIIIVIVNFSEARLLTPSWNWLMYITTSLSLSLSYQRIRMGIKEDLK
AEFMSSNRITVRE
Download sequence
Identical sequences Q3MDD2
240292.Ava_1380 gi|75907603|ref|YP_321899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]