SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3MEX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MEX6
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily ITPase-like 4.19e-59
Family Maf-like 0.0000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3MEX6
Sequence length 197
Comment (sp|Q3MEX6|Y836_ANAVT) Maf-like protein Ava_0836 {ECO:0000255|HAMAP-Rule:MF_00528} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_0836; OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MKTTQFILASASPARRRLLQTVGIEPIVSPSDFDESQIEETEPGKLVQILAQCKAETVAP
QFPSGLVMGCDSVLAIDGKIHGKPIDADEAIARWQLMRGQVGDLYTGHVLIDNLQNRTLV
KCQVTRVYFANISDRTIQAYVATGEPLKCAGAFALEGFGSLFIEKIAGCHSNVIGLSLPL
LRQMLEELNYDVTDFWK
Download sequence
Identical sequences A0A1W5CK71 Q3MEX6
240292.Ava_0836 gi|75907059|ref|YP_321355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]