SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3MHN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MHN7
Domain Number 1 Region: 156-251
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.02e-22
Family Middle domain of MutM-like DNA repair proteins 0.02
Further Details:      
 
Domain Number 2 Region: 62-113
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000196
Family N-terminal domain of MutM-like DNA repair proteins 0.01
Further Details:      
 
Domain Number 3 Region: 319-346
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000445
Family Ran binding protein zinc finger-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3MHN7
Sequence length 606
Comment (sp|Q3MHN7|NEIL3_BOVIN) Nei-like protein 3 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=NEIL3; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MVEGPGCTLNGEKIRARVRPGQAVTDVRGRALQGLGGPGSPPAAPGPMGTSQAAALNNNK
NSSQDFLRLFNGHGYSGVETLGKELFMYFGPKALRIHFGMKGSLVINPLESKNKNGVSPV
FEVQLTKDLICFFDSSVEIRNSTESQQRIRVMEELDVCSPRFSFSRAESEVKKQKGRMLC
DVLMDQKVLPGVGNIIKNEALFDSGFHPSVKVCQLTDEQIHHLVKMIRNFSILFYRCCKV
GSALSKHYKVYKRPNCGQCCCKITVCRLGENNRMTYFCPHCQKENPQHVDIRMLPVRNTT
VNWPSSRERHLMDCVAQKSEEQWTCEVCTLINKLSSKTCDACLTSRPADSVLRNEGNPIV
FNNLMKYPCNSFGKSKAKVKINRKTAFGTTTLVLTDFSNKHSALEREESHSHIPDGEFPS
PPPNVCGSDTLNTSKERTNCRSQPSDKVNISPVVCSQYKLFSPAHKKLKTTHYSSPDLKS
CNPGFSNSELQSSMTDGPCLLNAGSPRCSKHGRPCALRVVRKSGENKGRHFYACPLAREA
QCGFFEWADLSFPFCNHGKRSIMRTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAQNGPGI
NIIPGC
Download sequence
Identical sequences Q3MHN7
ENSBTAP00000007661 ENSBTAP00000007661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]