SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3SKE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3SKE6
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.89e-31
Family Sfri0576-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3SKE6
Sequence length 122
Comment (tr|Q3SKE6|Q3SKE6_THIDA) Uncharacterized protein {ECO:0000313|EMBL:AAZ96837.1} KW=Complete proteome; Reference proteome OX=292415 OS=Thiobacillus denitrificans (strain ATCC 25259). GN=Tbd_0884 OC=Thiobacillaceae; Thiobacillus.
Sequence
MISLDVDQNLIAVTVMGQFTLADYREFEEAVAHGIAFEGKVNLLFDLRDMLSYSVDVAWE
ELKFSREHKNDFGRIAILTGDEWVAWSMWVNRMFMSADIRLFDELEAAQAWVTGGELPAP
VI
Download sequence
Identical sequences Q3SKE6
gi|74316902|ref|YP_314642.1| WP_011311396.1.100243 292415.Tbd_0884 372233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]