SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3STR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3STR1
Domain Number 1 Region: 9-189
Classification Level Classification E-value
Superfamily SIS domain 8.29e-49
Family mono-SIS domain 0.0000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3STR1
Sequence length 197
Comment (tr|Q3STR1|Q3STR1_NITWN) Sedoheptulose 7-phosphate isomerase {ECO:0000256|HAMAP-Rule:MF_00067} KW=Complete proteome; Reference proteome OX=323098 OS=NCIMB 11846 / Nb-255). GN=Nwi_1068 OC=Bradyrhizobiaceae; Nitrobacter.
Sequence
MSQNPIAVHFQQSLAALQRAANDTTLLAAASEIAVTIIDALRSGNKVLLIGNGGSAADAQ
HIASEIVGRYRKERPGYAAIALTTDTSALTAISNDYGFERIFCRQIESLGRPGDILLALS
TSGRSPNILTALDAARRLGLVTAGFTGLKGQSLREVCDHLLVAPSDDTPVIQQIHMTAAH
AICDTVEHALADGDSDR
Download sequence
Identical sequences Q3STR1
323098.Nwi_1068 WP_011314364.1.37845 gi|75675261|ref|YP_317682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]