SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3SU48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3SU48
Domain Number 1 Region: 19-286
Classification Level Classification E-value
Superfamily SIS domain 5.56e-56
Family mono-SIS domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3SU48
Sequence length 325
Comment (tr|Q3SU48|Q3SU48_NITWN) Sugar isomerase, KpsF/GutQ family protein {ECO:0000313|EMBL:ABA04193.1} KW=Complete proteome; Reference proteome OX=323098 OS=NCIMB 11846 / Nb-255). GN=Nwi_0931 OC=Bradyrhizobiaceae; Nitrobacter.
Sequence
MIDQANIAIESALRTFEAEAGGVSALAAALKSDLGLAFAAATDLIRNAKGRLIVTGLGKS
GHIGRKIAATFASTGTPAFFVHAAEASHGDLGMITADDVIMALSWSGEQPEMKNLITYAK
RFRIPLIAMTAERDSTLGKAADVALVQPKAREACPHNLAPTTSSLMQLALGDGLAIALLE
GRGFTSVDFSVLHPGGKLGALLKYTRDLMHSGDAIPLKPLGTKMSEALVEMTSKGFGCVG
VTDGQGNLVGIVTDGDLRRHMRPDLMTARVDDVMTPHPKTIGRDLLAGEALEILNSSKIT
ALIVTEGKKPVGIVHLHDLLRAGVA
Download sequence
Identical sequences Q3SU48
323098.Nwi_0931 gi|75675124|ref|YP_317545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]