SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3SZI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3SZI1
Domain Number 1 Region: 161-467
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.97e-69
Family Papain-like 0.000016
Further Details:      
 
Domain Number 2 Region: 93-157
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000816
Family VWC domain 0.068
Further Details:      
 
Weak hits

Sequence:  Q3SZI1
Domain Number - Region: 73-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00119
Family Somatomedin B domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3SZI1
Sequence length 476
Comment (sp|Q3SZI1|TINAG_BOVIN) Tubulointerstitial nephritis antigen KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TINAG; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MCAGYKILILAYLTTEIWMERQYLSQREVDPGAEFTRNHTISEGTRFKRAVFEGQYCRRF
GCCADRDDGCVTQFYEADALCYCDKFCERENSDCCPDYKSFCREEKGWPPRTKPWSPEGC
HRDGQHYEEGSVIKENCNSCTCSGQQWKCSQHVCLVQPGLIEHVNKGDYGWTAQNYSQFW
GMTLEEGFKYRLGTLPPSPLLLSMNEVTASLTKTTDLPEFFIASYKWPGWTHGPLDQKNC
AASWAFSTASVAADRIAIQSQGRYTANLSPQNLISCCAKKRHGCNSGSVDRAWWYLRKRG
LVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATTPCPNSIEKSNRIYQCSPPYRVSSN
ETEIMREIMQNGPVQAIMQVHEDFFNYKTGIYRHITSTNEDSEKYRKFRTHAVKLTGWGT
LRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSADEP
Download sequence
Identical sequences Q3SZI1
ENSBTAP00000016790 NP_001030279.1.59421 NP_001030279.1.76553 ENSBTAP00000016790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]