SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3TKJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3TKJ2
Domain Number 1 Region: 199-313
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-33
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 2 Region: 83-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000463
Family First domain of FERM 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3TKJ2
Sequence length 321
Comment (tr|Q3TKJ2|Q3TKJ2_MOUSE) Uncharacterized protein {ECO:0000313|EMBL:BAE39153.1} OX=10090 OS=Mus musculus (Mouse). GN=Tln2 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MKMVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDP
RKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTIC
SRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDH
SRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKAC
EFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAK
VKYVKLARSLRTYGVSFFLVK
Download sequence
Identical sequences Q3TKJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]