SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3YT97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q3YT97
Domain Number - Region: 128-191
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0575
Family Capz beta-1 subunit 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3YT97
Sequence length 191
Comment (sp|Q3YT97|PLSY_EHRCJ) Lysophosphatidic acid synthase {ECO:0000255|HAMAP-Rule:MF_01043} KW=Complete proteome OX=269484 OS=Ehrlichia canis (strain Jake). GN=Ecaj_0007; OC=Anaplasmataceae; Ehrlichia.
Sequence
MNIYTSILVLSYLIGSIPFGLILSYIGGLGDIRKIGSGNIGATNVFRKSKKLAVVTLILD
SLKGFVSVMLAKNFSSDQTFVFMSALFSIIGHMFPVWLSFKGGKGVATLLGSIMFIEYKF
VIYFTIFWIIVFVIFRYSSLSSIISTISIMLLVYTHYSANESITFLVMSLLVIVQHIENI
VRIIKGKENKI
Download sequence
Identical sequences Q3YT97
gi|73666640|ref|YP_302656.1| WP_011304136.1.16298 269484.Ecaj_0007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]