SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q468J7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q468J7
Domain Number 1 Region: 300-386
Classification Level Classification E-value
Superfamily PKD domain 7.19e-29
Family PKD domain 0.00039
Further Details:      
 
Domain Number 2 Region: 388-468
Classification Level Classification E-value
Superfamily PKD domain 3.01e-28
Family PKD domain 0.00048
Further Details:      
 
Domain Number 3 Region: 469-550
Classification Level Classification E-value
Superfamily PKD domain 1.06e-27
Family PKD domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q468J7
Sequence length 551
Comment (tr|Q468J7|Q468J7_METBF) Uncharacterized protein {ECO:0000313|EMBL:AAZ71695.1} KW=Complete proteome; Reference proteome OX=269797 OS=Methanosarcina barkeri (strain Fusaro / DSM 804). GN=Mbar_A2794 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MNRKLILILLTLILSSGVCLADNFVGGIPLTSVHSGTVSGGVYCDSYYGTADQAIHTAKT
IDKTFTLPANAKVEWAMLLTTVYCGHMQNNYQGLAKVSFNGQTLGTETLNVPYNYITNGG
NDGKAYVQVNDHVDRVTSDYMMYYDVTSLVKSGKNKATVHTEPTDKKFDGRIKLITLIVA
YNDGSGKKIWYQVNRGHDPDTYYSENNLGENYIGSTAFKAALPASSTLTSATLTDVHMAS
TDGSYTFNGKTLTSGKPQGTYCGSDSWDVKNNFKSTGTNTLTYDRNAPFYKNSLAILTAE
YKTSSNKPVAAFSASPTSGKAPLKVKFTDTSTGIPSKWFWNFGDGSKSFQQNPVHKYSKA
GTYTVSLTVKNAKGKNTVTKTEYIKVIAKPVAAFSASPTFGKAPLKVKFTDKSTGTPKKW
KWNFGDGKISAKQNPIHKYSKAGKYKVTLTVANAAGINTVTKTNYITVIAKPVAAFSASP
TSGKAPLKVTFTDKSTGTPKKWKWNFGDGKISAKQNPIHKYSKAGKYKVTLTVANAAGIN
TKTISNYIIVK
Download sequence
Identical sequences A0A0E3QMI6 Q468J7
NYSGXRC-10384f gi|73670260|ref|YP_306275.1| 269797.Mbar_A2794 WP_011307736.1.36239 WP_011307736.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]