SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q468U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q468U3
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.09e-24
Family Transposase IS200-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q468U3
Sequence length 93
Comment (tr|Q468U3|Q468U3_METBF) Transposase {ECO:0000313|EMBL:AAZ71599.1} KW=Complete proteome; Reference proteome OX=269797 OS=Methanosarcina barkeri (strain Fusaro / DSM 804). GN=Mbar_A2695 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MIDISKKSNFEILEMETDKDHIHLVIKSEPKVSVLSIVRKLKQESTNGLWKTQKEYLEKY
YWGENTLWSDGYFASTIGNVSKEAVEYYIRNQG
Download sequence
Identical sequences A0A0E3LLH6 Q468U3
gi|73670164|ref|YP_306179.1| 269797.Mbar_A2695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]