SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q469K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q469K8
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily Transposase IS200-like 3.53e-40
Family Transposase IS200-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q469K8
Sequence length 149
Comment (tr|Q469K8|Q469K8_METBF) Uncharacterized protein {ECO:0000313|EMBL:AAZ71434.1} KW=Complete proteome; Reference proteome OX=269797 OS=Methanosarcina barkeri (strain Fusaro / DSM 804). GN=Mbar_A1248 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MELRHANHCVYKIRYHMVFCMKYRKKLLLDAEIISFLKTICFGIGERYCFEFDAIGTDGD
HVHLFVGAEPKYSPSRVMQIIKSITARQIFKQYPEIKKQLWGSELWSDGGYIGTVGDGTT
SDVIKSYIENQGNQEEKEAYKQMKIIDFQ
Download sequence
Identical sequences A0A0E3QQX2 Q469K8
269797.Mbar_A1248 269797.Mbar_A2521 WP_011306259.1.36239 WP_011306259.1.74748 gi|73668777|ref|YP_304792.1| gi|73669999|ref|YP_306014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]