SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q47MR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q47MR1
Domain Number 1 Region: 79-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000101
Family NfeD domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q47MR1
Sequence length 146
Comment (tr|Q47MR1|Q47MR1_THEFY) Putative integral membrane protein {ECO:0000313|EMBL:AAZ56259.1} KW=Complete proteome; Reference proteome OX=269800 OS=Thermobifida fusca (strain YX). GN=Tfu_2226 OC=Thermobifida.
Sequence
MSVWVVWLVLAVALGVAELFTLTLALGLIGAAALIAGVVGAFGVGLTGQVLVFAVASAAG
LLVVRPIARRHMTQPPPLRSGTEALVGRSALVVEEITATGGRIKLQGEEWSARCLDETLR
IPVGAHVDVMEIEGATAVVYPRDELP
Download sequence
Identical sequences Q47MR1
gi|72162625|ref|YP_290282.1| WP_011292649.1.46431 WP_011292649.1.72373 WP_011292649.1.82272 269800.Tfu_2226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]